Recombinant Human PTH therapeutic protein
Cat.No. : | PTH-P062H |
Product Overview : | Recombinant human parathyroid hormone is a potent anabolic agent used in the treatment of osteoporosis. |
- Specification
- Gene Information
- Related Products
Description : | Our expression product is the active ingredient of Apthela, Forsteo, Forteo, Fortessa, Opthia, Optia, Optiah, Zalectra and Zelletra. |
Species : | Human |
Molecular Mass : | 4.12 Kda |
Protein length : | 34 Aa |
AA Sequence : | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Gene Name : | PTH parathyroid hormone [ Homo sapiens ] |
Official Symbol : | PTH |
Synonyms : | PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1; |
Gene ID : | 5741 |
mRNA Refseq : | NM_000315 |
Protein Refseq : | NP_000306 |
MIM : | 168450 |
UniProt ID : | P01270 |
Chromosome Location : | 11p15.3-p15.1 |
Pathway : | Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Osteoblast Signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
Function : | hormone activity; parathyroid hormone receptor binding; peptide hormone receptor binding; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
PTH-3941H | Recombinant Human PTH Protein, His (Fc)-Avi-tagged | +Inquiry |
PTH-0046H | Recombinant Human PTH Protein | +Inquiry |
PTH-4477R | Recombinant Rat PTH Protein, His (Fc)-Avi-tagged | +Inquiry |
PTH-2516H | Recombinant Human PTH protein(41-110 aa), C-His-tagged | +Inquiry |
Pth-7850M | Recombinant Mouse Pth protein, His & GST-tagged | +Inquiry |
◆ Lysates | ||
PTH-1273HCL | Recombinant Human PTH cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-1497 | PTH Bioassay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket