Recombinant Human PTK7
Cat.No. : | PTK7-27862TH |
Product Overview : | Recombinant fragment corresponding to amino acids 36-145 of Human CCK4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Receptor protein tyrosine kinases transduce extracellular signals across the cell membrane. A subgroup of these kinases lack detectable catalytic tyrosine kinase activity but retain roles in signal transduction. The protein encoded by this gene is a member of this subgroup of tyrosine kinases and may function as a cell adhesion molecule. This gene is thought to be expressed in colon carcinomas but not in normal colon, and therefore may be a marker for or may be involved in tumor progression. Four transcript variants encoding four different isoforms have been found for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDT ERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSA NASFNIKWIEAGPVVLKHPASEAEIQPQTQ |
Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.Contains 7 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain. |
Gene Name : | PTK7 PTK7 protein tyrosine kinase 7 [ Homo sapiens ] |
Official Symbol : | PTK7 |
Synonyms : | PTK7; PTK7 protein tyrosine kinase 7; inactive tyrosine-protein kinase 7; CCK4; |
Gene ID : | 5754 |
mRNA Refseq : | NM_002821 |
Protein Refseq : | NP_002812 |
MIM : | 601890 |
Uniprot ID : | Q13308 |
Chromosome Location : | 6p21.1-p12.2 |
Function : | ATP binding; receptor activity; transferase activity, transferring phosphorus-containing groups; transmembrane receptor protein tyrosine kinase activity; |
Products Types
◆ Recombinant Protein | ||
PTK7-7266M | Recombinant Mouse PTK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTK7-01H | Active Recombinant Human PTK7 Protein, Fc-tagged | +Inquiry |
PTK7-13660M | Recombinant Mouse PTK7 Protein, His and Myc tagged | +Inquiry |
Ptk7-5229M | Recombinant Mouse Ptk7 Protein, Myc/DDK-tagged | +Inquiry |
PTK7-1659H | Recombinant Human PTK7 Protein (31-704 aa), His-tagged | +Inquiry |
◆ Lysates | ||
PTK7-2697HCL | Recombinant Human PTK7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket