Recombinant Human PTPRO
Cat.No. : | PTPRO-28853TH |
Product Overview : | Recombinant full length Human GLEPP1 according to AAH35960.1, with N-terminal proprietary tag.Mol Wt 91.78 kda inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. |
Protein length : | 598 amino acids |
Molecular Weight : | 91.780kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Glomerulus of kidney. Also detected in brain, lung and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNI VVSLEASDVISPASVYVVKITGESKNYFFEFEEFNSTLPP PVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLP VTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEG KDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATF NKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNW EEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNIS SGWPDFNSSDYETTSQPYWWDSASAAPESEDEFVSVLPME YENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDG FHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTT FSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVS VHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQR LEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPP SDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRK YVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP |
Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.Contains 8 fibronectin type-III domains.Contains 1 tyrosine-protein phosphatase domain. |
Gene Name : | PTPRO protein tyrosine phosphatase, receptor type, O [ Homo sapiens ] |
Official Symbol : | PTPRO |
Synonyms : | PTPRO; protein tyrosine phosphatase, receptor type, O; receptor-type tyrosine-protein phosphatase O; GLEPP1; NPHS6; osteoclastic transmembrane protein tyrosine phosphatase; PTP oc; PTP U2; PTPU2; |
Gene ID : | 5800 |
mRNA Refseq : | NM_002848 |
Protein Refseq : | NP_002839 |
MIM : | 600579 |
Uniprot ID : | Q16827 |
Chromosome Location : | 12p13-p12 |
Pathway : | Signaling events mediated by Stem cell factor receptor (c-Kit), organism-specific biosystem; |
Function : | hydrolase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PTPRO-7289M | Recombinant Mouse PTPRO Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPRO-2643H | Recombinant Human PTPRO Protein, His-tagged | +Inquiry |
Ptpro-5250M | Recombinant Mouse Ptpro Protein, Myc/DDK-tagged | +Inquiry |
PTPRO-5438Z | Recombinant Zebrafish PTPRO | +Inquiry |
PTPRO-28582TH | Recombinant Human PTPRO | +Inquiry |
◆ Lysates | ||
PTPRO-2672HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry |
PTPRO-2673HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry |
PTPRO-2674HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All PTPRO Products
Required fields are marked with *
My Review for All PTPRO Products
Required fields are marked with *
0
Inquiry Basket