Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RAP2B

Cat.No. : RAP2B-30505TH
Product Overview : Recombinant Full Length Human RAP2B expressed in Saccharomyces cerevisiae; amino acids 1-183; 183 amino acids, 20.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFY RKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL VYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEI VRQMNYAAQPNGDEGCCSACVIL
Gene Name : RAP2B RAP2B, member of RAS oncogene family [ Homo sapiens ]
Official Symbol : RAP2B
Synonyms : RAP2B; RAP2B, member of RAS oncogene family; ras-related protein Rap-2b; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; small GTP binding protein;
Gene ID : 5912
mRNA Refseq : NM_002886
Protein Refseq : NP_002877
MIM : 179541
Uniprot ID : P61225
Chromosome Location : 3q25.2
Function : GTP binding; GTPase activity; nucleotide binding; protein domain specific binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RAP2B Products

Required fields are marked with *

My Review for All RAP2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends