Recombinant Human RB1, His-tagged

• Cat.No.: RB1-31044TH
• Product Overview: Recombinant fragment, corresponding to amino acids 792-928 of Human Rb with 6X His tag; 146 amino acids, 16.5 kDa

Specification

• Description: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Expressed in the retina.
• Form: Lyophilised:Reconstitute in sterile 18MO-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20mM PBS, pH 7.4
• Storage: Store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
• Sequences of amino acids: MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPR SRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNP PKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTR TRMQKQKMNDSMDTSNKEEKHHHHHH
• Sequence Similarities: Belongs to the retinoblastoma protein (RB) family.

Gene Information

• Gene Name: RB1 retinoblastoma 1 [ Homo sapiens ]
• Official Symbol: RB1
• Synonyms: RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB
• Gene ID: 5925
• mRNA Refseq: NM_000321
• Protein Refseq: NP_000312
• MIM: 614041
• Uniprot ID: P06400
• Chromosome Location: 13q14.2
• Pathway: Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem
• Function: DNA binding; RNA polymerase II activating transcription factor binding; androgen receptor binding; core promoter binding; kinase activity

Reviews

07/15/2022

Efficient protein purification, delivers consistent yield and purity.

01/19/2021

Expertise in protein engineering, a trusted resource for research.

10/09/2019

Reliable protein crystallization services, exceptional results achieved.

Q&As

What is the impact of RB1 mutations on the development of retinoblastoma and other cancers?

Mutations in RB1 lead to retinoblastoma and increase the risk of other cancers, disrupting normal cell cycle control.

How does RB1 interact with transcription factors and affect gene expression?

RB1 interacts with transcription factors to regulate gene expression, impacting various cellular processes.

What role does RB1 play in DNA damage response and repair mechanisms?

RB1 plays a crucial role in the DNA damage response, facilitating repair and maintaining genomic stability.

How does RB1 regulate the cell cycle, particularly the transition from G1 to S phase?

RB1 controls the G1 to S phase transition in the cell cycle, preventing unregulated cell division.

How do alterations in RB1 expression or function influence stem cell differentiation and tissue regeneration?

Changes in RB1 function affect stem cell differentiation and tissue regeneration, influencing tissue maintenance and repair.

What are the mechanisms by which RB1 modulates cellular senescence and apoptosis?

RB1 influences cellular senescence and apoptosis, playing a role in aging and cell turnover.

How does RB1 contribute to tumor suppression and the prevention of uncontrolled cell proliferation?

As a tumor suppressor, RB1 prevents excessive cell proliferation and contributes to cancer prevention.