Recombinant Human RBBP7
Cat.No. : | RBBP7-29048TH |
Product Overview : | Recombinant full length Human RbAp46 (amino acids 1-425) with N terminal proprietary tag; Predicted MWt 72.82 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 425 amino acids |
Molecular Weight : | 72.820kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQ WPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVV ARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKP DPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHT VCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIF QVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI WQMAENIYNDEESDVTTSELEGQGS |
Sequence Similarities : | Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.Contains 7 WD repeats. |
Gene Name : | RBBP7 retinoblastoma binding protein 7 [ Homo sapiens ] |
Official Symbol : | RBBP7 |
Synonyms : | RBBP7; retinoblastoma binding protein 7; histone-binding protein RBBP7; G1/S transition control protein binding protein RbAp46; histone acetyltransferase type B subunit 2; RbAp46; retinoblastoma binding protein p46; retinoblastoma binding protein RbAp46; |
Gene ID : | 5931 |
mRNA Refseq : | NM_001198719 |
Protein Refseq : | NP_001185648 |
MIM : | 300825 |
Uniprot ID : | Q16576 |
Chromosome Location : | Xp22.22 |
Pathway : | Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem; Nucleosome assembly, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
RBBP7-588C | Recombinant Cynomolgus Monkey RBBP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rbbp7-5402M | Recombinant Mouse Rbbp7 Protein, Myc/DDK-tagged | +Inquiry |
RBBP7-1863H | Recombinant Human RBBP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBBP7-1010H | Recombinant Human RBBP7 Protein (1-425 aa), His-SUMO-tagged | +Inquiry |
RBBP7-7459M | Recombinant Mouse RBBP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
RBBP7-2489HCL | Recombinant Human RBBP7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RBBP7 Products
Required fields are marked with *
My Review for All RBBP7 Products
Required fields are marked with *
0
Inquiry Basket