Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RBBP9, His-tagged

Cat.No. : RBBP9-26383TH
Product Overview : Recombinant full length Human RBBP9 with an N terminal His tag; 206 amino acids with a predicted MWt of 23.1 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Protein length : 186 amino acids
Conjugation : HIS
Molecular Weight : 23.100kDa inclusive of tags
Source : E. coli
Tissue specificity : Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTT HGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFME TELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYT SDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA
Sequence Similarities : Belongs to the RBBP9 family.
Gene Name : RBBP9 retinoblastoma binding protein 9 [ Homo sapiens ]
Official Symbol : RBBP9
Synonyms : RBBP9; retinoblastoma binding protein 9; putative hydrolase RBBP9; Bog;
Gene ID : 10741
mRNA Refseq : NM_006606
Protein Refseq : NP_006597
MIM : 602908
Uniprot ID : O75884
Chromosome Location : 20p11.2
Function : hydrolase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RBBP9 Products

Required fields are marked with *

My Review for All RBBP9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends