Recombinant Human RBBP9, His-tagged
Cat.No. : | RBBP9-26383TH |
Product Overview : | Recombinant full length Human RBBP9 with an N terminal His tag; 206 amino acids with a predicted MWt of 23.1 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. |
Protein length : | 186 amino acids |
Conjugation : | HIS |
Molecular Weight : | 23.100kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTT HGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFME TELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYT SDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA |
Sequence Similarities : | Belongs to the RBBP9 family. |
Gene Name : | RBBP9 retinoblastoma binding protein 9 [ Homo sapiens ] |
Official Symbol : | RBBP9 |
Synonyms : | RBBP9; retinoblastoma binding protein 9; putative hydrolase RBBP9; Bog; |
Gene ID : | 10741 |
mRNA Refseq : | NM_006606 |
Protein Refseq : | NP_006597 |
MIM : | 602908 |
Uniprot ID : | O75884 |
Chromosome Location : | 20p11.2 |
Function : | hydrolase activity; |
Products Types
◆ Recombinant Protein | ||
RBBP9-3623R | Recombinant Rhesus Macaque RBBP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBBP9-4611R | Recombinant Rat RBBP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rbbp9-5404M | Recombinant Mouse Rbbp9 Protein, Myc/DDK-tagged | +Inquiry |
RBBP9-2202H | Recombinant Human RBBP9, GST-tagged | +Inquiry |
RBBP9-3837Z | Recombinant Zebrafish RBBP9 | +Inquiry |
◆ Lysates | ||
RBBP9-2488HCL | Recombinant Human RBBP9 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RBBP9 Products
Required fields are marked with *
My Review for All RBBP9 Products
Required fields are marked with *
0
Inquiry Basket