Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RBP1

Cat.No. : RBP1-30075TH
Product Overview : Recombinant full length Human RBP1 with N-terminal proprietary tag.Mol Wt 40.92 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 135 amino acids
Molecular Weight : 40.920kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ
Sequence Similarities : Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Gene Name : RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
Official Symbol : RBP1
Synonyms : RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC;
Gene ID : 5947
mRNA Refseq : NM_001130992
Protein Refseq : NP_001124464
MIM : 180260
Uniprot ID : P09455
Chromosome Location : 3q21-q23
Pathway : Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem;
Function : lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RBP1 Products

Required fields are marked with *

My Review for All RBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends