Recombinant Human RELA
Cat.No. : | RELA-30384TH |
Product Overview : | Recombinant fragment of Human NFkB p65 with a N terminal proprietary tag; 50.27 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 220 amino acids |
Molecular Weight : | 50.270kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEG RSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC FQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN RNSGSCLGGDEIFLLCDKVQ |
Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
Gene Name : | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
Official Symbol : | RELA |
Synonyms : | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65; |
Gene ID : | 5970 |
mRNA Refseq : | NM_001145138 |
Protein Refseq : | NP_001138610 |
MIM : | 164014 |
Uniprot ID : | Q04206 |
Chromosome Location : | 11q13 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
Function : | DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding; |
Products Types
◆ Recombinant Protein | ||
RELA-627TH | Recombinant Human RELA, C-Terminal Truncated | +Inquiry |
RELA-1878H | Recombinant Human RELA Protein, His (Fc)-Avi-tagged | +Inquiry |
Rela-5456M | Recombinant Mouse Rela Protein, Myc/DDK-tagged | +Inquiry |
RELA-333H | Recombinant Human NFκB3 (RELA/p65) Protein, Flag-tagged | +Inquiry |
rela-2736Z | Recombinant Zebrafish rela Protein, His-tagged | +Inquiry |
◆ Lysates | ||
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1652 | HEK 293 RELA Nuclear Translocation Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket