Recombinant Human RERE
Cat.No. : | RERE-29593TH |
Product Overview : | Recombinant fragment of Human RERE (amino acids 85-193) with N terminal proprietary tag, 37.62 kD. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 109 amino acids |
Molecular Weight : | 37.620kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. Expressed in tumor cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFI CSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQH LSEAGRGPVGSKRDHLLMNVKWYYRQSEV |
Sequence Similarities : | Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain. |
Gene Name : | RERE arginine-glutamic acid dipeptide (RE) repeats [ Homo sapiens ] |
Official Symbol : | RERE |
Synonyms : | RERE; arginine-glutamic acid dipeptide (RE) repeats; ATN1L; arginine-glutamic acid dipeptide repeats protein; ARG; ARP; DNB1; KIAA0458; |
Gene ID : | 473 |
mRNA Refseq : | NM_001042681 |
Protein Refseq : | NP_001036146 |
MIM : | 605226 |
Uniprot ID : | Q9P2R6 |
Chromosome Location : | 1p36.23 |
Function : | metal ion binding; poly-glutamine tract binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
RERE-7527M | Recombinant Mouse RERE Protein, His (Fc)-Avi-tagged | +Inquiry |
RERE-4657R | Recombinant Rat RERE Protein, His (Fc)-Avi-tagged | +Inquiry |
RERE-3668R | Recombinant Rhesus Macaque RERE Protein, His (Fc)-Avi-tagged | +Inquiry |
RERE-3851R | Recombinant Rhesus monkey RERE Protein, His-tagged | +Inquiry |
RERE-4998R | Recombinant Rat RERE Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RERE Products
Required fields are marked with *
My Review for All RERE Products
Required fields are marked with *
0
Inquiry Basket