Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RERE

Cat.No. : RERE-29593TH
Product Overview : Recombinant fragment of Human RERE (amino acids 85-193) with N terminal proprietary tag, 37.62 kD.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed. Expressed in tumor cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFI CSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQH LSEAGRGPVGSKRDHLLMNVKWYYRQSEV
Sequence Similarities : Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain.
Gene Name : RERE arginine-glutamic acid dipeptide (RE) repeats [ Homo sapiens ]
Official Symbol : RERE
Synonyms : RERE; arginine-glutamic acid dipeptide (RE) repeats; ATN1L; arginine-glutamic acid dipeptide repeats protein; ARG; ARP; DNB1; KIAA0458;
Gene ID : 473
mRNA Refseq : NM_001042681
Protein Refseq : NP_001036146
MIM : 605226
Uniprot ID : Q9P2R6
Chromosome Location : 1p36.23
Function : metal ion binding; poly-glutamine tract binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RERE Products

Required fields are marked with *

My Review for All RERE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends