Recombinant Human RHOA, GST-tagged
Cat.No. : | RHOA-301418H |
Product Overview : | Recombinant Human GFP (123-161 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Asn123-Ala161 |
AA Sequence : | NDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | RHOA ras homolog family member A [ Homo sapiens ] |
Official Symbol : | RHOA |
Synonyms : | RHOA; ras homolog family member A; ARH12, ARHA, ras homolog gene family, member A; transforming protein RhoA; Rho12; RhoA; RHOH12; h12; oncogene RHO H12; rho cDNA clone 12; Aplysia ras-related homolog 12; small GTP binding protein RhoA; ras homolog gene family, member A; ARHA; ARH12; RHO12; |
Gene ID : | 387 |
mRNA Refseq : | NM_001664 |
Protein Refseq : | NP_001655 |
MIM : | 165390 |
UniProt ID : | P61586 |
Products Types
◆ Recombinant Protein | ||
RHOA-1182H | Recombinant Human RHOA Protein, MYC/DDK-tagged | +Inquiry |
RHOA-2655H | Recombinant Human RHOA Protein, His-tagged | +Inquiry |
Rhoa-641M | Recombinant Mouse Rhoa Protein, MYC/DDK-tagged | +Inquiry |
RHOA-1888H | Recombinant Human RHOA Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOA-160H | Recombinant Human RHOA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Lysates | ||
RHOA-601HCL | Recombinant Human RHOA cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-0768 | RhoA Activation ColorimetricAssay Kit (24 assays) | +Inquiry |
Kit-0769 | RhoA Activation Colorimetric Assay Kit (96 assays) | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket