Recombinant Human RNF130, His-tagged
Cat.No. : | RNF130-31331TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 112-306 of Human RNF130 with a N terminal His tag; 27kDa, |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 55 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NARDRNQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHC AVCIESYKQNDVVRILPCKHVFHKSCVDPWLSEHCTCP MCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRR SALGDLAGDNSLGLEPLRTSGISPLPQDGELTPRTGEINI AVTKEWFIIASFGLLSALTLCYMIIRATASLNANEVEW F |
Gene Name : | RNF130 ring finger protein 130 [ Homo sapiens ] |
Official Symbol : | RNF130 |
Synonyms : | RNF130; ring finger protein 130; E3 ubiquitin-protein ligase RNF130; G1RZFP; GOLIATH; GP; |
Gene ID : | 55819 |
mRNA Refseq : | NM_018434 |
Protein Refseq : | NP_060904 |
Uniprot ID : | Q86XS8 |
Chromosome Location : | 5q35.3 |
Function : | ligase activity; metal ion binding; ubiquitin-protein ligase activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
RNF130-7649M | Recombinant Mouse RNF130 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF130-14298M | Recombinant Mouse RNF130 Protein | +Inquiry |
◆ Lysates | ||
RNF130-2299HCL | Recombinant Human RNF130 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RNF130 Products
Required fields are marked with *
My Review for All RNF130 Products
Required fields are marked with *
0
Inquiry Basket