Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RPL12

Cat.No. : RPL12-31150TH
Product Overview : Recombinant full length Human RPL12 with N-terminal proprietary tag. Predicted MW 44.22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L11P family of ribosomal proteins. It is located in the cytoplasm. The protein binds directly to the 26S rRNA. This gene is co-transcribed with the U65 snoRNA, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Protein length : 165 amino acids
Molecular Weight : 44.220kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPK KVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASAL IIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV ECPAS
Sequence Similarities : Belongs to the ribosomal protein L11P family.
Gene Name : RPL12 ribosomal protein L12 [ Homo sapiens ]
Official Symbol : RPL12
Synonyms : RPL12; ribosomal protein L12; 60S ribosomal protein L12; L12;
Gene ID : 6136
mRNA Refseq : NM_000976
Protein Refseq : NP_000967
MIM : 180475
Uniprot ID : P30050
Chromosome Location : 9q34
Pathway : Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem;
Function : RNA binding; structural constituent of ribosome;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RPL12 Products

Required fields are marked with *

My Review for All RPL12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends