Recombinant Human RPS6KA4, His-tagged
Cat.No. : | RPS6KA4-29913TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 269-572 of Human MSK2 / RSK-B isoform 2 with a N terminal His tag; Pred MWt 34kDa: |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and c-fos. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 166 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPFFQGLDWVA LAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPG SPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGA GDRPGRAAVARSAMMQQYELDLREPALGQGSFSVCRRCRQ RQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVN LHEVHHDQLHTYLVLELLRGGELLEHIRKKRHFSESEA SQILRSLVSAVSFMHEEAGVVHRDLKPENILYADDTPG APVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAP |
Gene Name : | RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 [ Homo sapiens ] |
Official Symbol : | RPS6KA4 |
Synonyms : | RPS6KA4; ribosomal protein S6 kinase, 90kDa, polypeptide 4; ribosomal protein S6 kinase, 90kD, polypeptide 4; ribosomal protein S6 kinase alpha-4; MSK2; RSK B; |
Gene ID : | 8986 |
mRNA Refseq : | NM_001006944 |
Protein Refseq : | NP_001006945 |
MIM : | 603606 |
Uniprot ID : | O75676 |
Chromosome Location : | 11q11-q13 |
Pathway : | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Insulin Signaling, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; |
Function : | ATP binding; magnesium ion binding; mitogen-activated protein kinase p38 binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Rps6ka4-5610M | Recombinant Mouse Rps6ka4 Protein, Myc/DDK-tagged | +Inquiry |
RPS6KA4-7793M | Recombinant Mouse RPS6KA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS6KA4-3846R | Recombinant Rhesus Macaque RPS6KA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS6KA4-4029R | Recombinant Rhesus monkey RPS6KA4 Protein, His-tagged | +Inquiry |
RPS6KA4-6718Z | Recombinant Zebrafish RPS6KA4 | +Inquiry |
◆ Lysates | ||
RPS6KA4-2160HCL | Recombinant Human RPS6KA4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RPS6KA4 Products
Required fields are marked with *
My Review for All RPS6KA4 Products
Required fields are marked with *
0
Inquiry Basket