Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RTN1

Cat.No. : RTN1-31317TH
Product Overview : Recombinant full length Human Reticulon 1 Isoform 3 with an N-terminal proprietary tag; predicted MWt 48.99 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants.
Protein length : 208 amino acids
Molecular Weight : 48.990kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSF LLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMA VVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE
Sequence Similarities : Contains 1 reticulon domain.
Gene Name : RTN1 reticulon 1 [ Homo sapiens ]
Official Symbol : RTN1
Synonyms : RTN1; reticulon 1; neuroendocrine specific protein , NSP; reticulon-1;
Gene ID : 6252
mRNA Refseq : NM_021136
Protein Refseq : NP_066959
MIM : 600865
Uniprot ID : Q16799
Chromosome Location : 14q21-q22
Function : signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RTN1 Products

Required fields are marked with *

My Review for All RTN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends