Recombinant Human SFTPC Protein (24-58 aa), His-tagged

• Cat.No.: SFTPC-1517H
• Product Overview: Recombinant Human SFTPC Protein (24-58 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein.

Specification

• Description: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 5.7 kDa
• Protein length: 24-58 aa
• AA Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: SFTPC surfactant protein C [ Homo sapiens ]
• Official Symbol: SFTPC
• Synonyms: SFTPC; PSP C; SMDP2; SP C; SP5; SP-C; PSP-C; SFTP2
• Gene ID: 6440
• mRNA Refseq: NM_001172357
• Protein Refseq: NP_001165828
• MIM: 178620
• UniProt ID: P11686