Recombinant Human SFTPC Protein (24-58 aa), His-tagged
Cat.No. : | SFTPC-1517H |
Product Overview : | Recombinant Human SFTPC Protein (24-58 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
Description : | Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. |
Source : | Yeast |
Species : | Human |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 5.7 kDa |
Protein length : | 24-58 aa |
AA Sequence : | FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name : | SFTPC surfactant protein C [ Homo sapiens ] |
Official Symbol : | SFTPC |
Synonyms : | SFTPC; PSP C; SMDP2; SP C; SP5; SP-C; PSP-C; SFTP2; |
Gene ID : | 6440 |
mRNA Refseq : | NM_001172357 |
Protein Refseq : | NP_001165828 |
MIM : | 178620 |
UniProt ID : | P11686 |
Products Types
◆ Recombinant Protein | ||
SFTPC-5018R | Recombinant Rat SFTPC Protein, His (Fc)-Avi-tagged | +Inquiry |
Sftpc-2055M | Recombinant Mouse Sftpc Protein, His-tagged | +Inquiry |
SFTPC-3994R | Recombinant Rhesus Macaque SFTPC Protein, His (Fc)-Avi-tagged | +Inquiry |
Sftpc-2056R | Recombinant Rat Sftpc Protein, His-tagged | +Inquiry |
Sftpc-5817M | Recombinant Mouse Sftpc Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket