Recombinant Human SHMT1, His-tagged
Cat.No. : | SHMT1-31357TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 184-483 of Human SHMT1, with N terminal His tag, 300aa, MWt 35kDa, |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGA YLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRG CRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPG LQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRA LSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVL EACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLE KDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLA GDKYQAAVQALREEVESFASLFPLPGLPDF |
Sequence Similarities : | Belongs to the SHMT family. |
Gene Name : | SHMT1 serine hydroxymethyltransferase 1 (soluble) [ Homo sapiens ] |
Official Symbol : | SHMT1 |
Synonyms : | SHMT1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase, cytosolic; 14 kDa protein; CSHMT; cytoplasmic serine hydroxymethyltransferase; MGC15229; MGC24556; SHMT; |
Gene ID : | 6470 |
mRNA Refseq : | NM_004169 |
Protein Refseq : | NP_004160 |
MIM : | 182144 |
Uniprot ID : | P34896 |
Chromosome Location : | 17p11.2 |
Pathway : | C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Carnitine synthesis, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; |
Function : | L-allo-threonine aldolase activity; amino acid binding; glycine hydroxymethyltransferase activity; glycine hydroxymethyltransferase activity; protein homodimerization activity; |
Products Types
◆ Recombinant Protein | ||
SHMT1-0576H | Recombinant Human SHMT1 Protein (D11-L480), Tag Free | +Inquiry |
Shmt1-5868M | Recombinant Mouse Shmt1 Protein, Myc/DDK-tagged | +Inquiry |
SHMT1-8158M | Recombinant Mouse SHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHMT1-4012R | Recombinant Rhesus Macaque SHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHMT1-0577H | Recombinant Human SHMT1 Protein (D11-L480), His tagged | +Inquiry |
◆ Lysates | ||
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
SHMT1-1854HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket