Recombinant Human SP110

• Cat.No.: SP110-31432TH
• Product Overview: Recombinant fragment corresponding to amino acids 271-380 of Human SP110 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Description: The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in peripheral blood leukocytes and spleen. Detected at intermediate levels in thymus, prostate, testis, ovary, small intestine and colon, and at low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQK KLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEE IIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
• Sequence Similarities: Contains 1 bromo domain.Contains 1 HSR domain.Contains 1 PHD-type zinc finger.Contains 1 SAND domain.

Gene Information

• Gene Name: SP110 SP110 nuclear body protein [ Homo sapiens ]
• Official Symbol: SP110
• Synonyms: SP110; SP110 nuclear body protein; IFI41, IFI75, interferon induced protein 41, 30kD; sp110 nuclear body protein
• Gene ID: 3431
• mRNA Refseq: NM_001185015
• Protein Refseq: NP_001171944
• MIM: 604457
• Uniprot ID: Q9HB58
• Chromosome Location: 2q37.1
• Function: DNA binding; binding; metal ion binding; signal transducer activity; zinc ion binding