Recombinant Human SPTBN2, His-tagged
Cat.No. : | SPTBN2-30886TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2149-2390 of Human SPTBN2 with an N terminal His tag; Predicted MWt 27 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Spectrins are principle components of a cells membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane. Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 143 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRG PAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLC RKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAA SAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD GKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVV PSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGRERERE KRFSFFKKNK |
Gene Name : | SPTBN2 spectrin, beta, non-erythrocytic 2 [ Homo sapiens ] |
Official Symbol : | SPTBN2 |
Synonyms : | SPTBN2; spectrin, beta, non-erythrocytic 2; SCA5, spinocerebellar ataxia 5; spectrin beta chain, brain 2; |
Gene ID : | 6712 |
mRNA Refseq : | NM_006946 |
Protein Refseq : | NP_008877 |
MIM : | 604985 |
Uniprot ID : | O15020 |
Chromosome Location : | 11q13.2 |
Pathway : | Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; |
Function : | actin binding; structural constituent of cytoskeleton; |
Products Types
◆ Recombinant Protein | ||
SPTBN2-5387R | Recombinant Rat SPTBN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPTBN2-5728R | Recombinant Rat SPTBN2 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket