Recombinant Human SRD5A2
Cat.No. : | SRD5A2-31394TH |
Product Overview : | Recombinant fragment of Human SRD5A2 with an N terminal proprietary tag; Predicted MW 29.81kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). |
Protein length : | 38 amino acids |
Molecular Weight : | 29.810kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in high levels in the prostate and many other androgen-sensitive tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA |
Sequence Similarities : | Belongs to the steroid 5-alpha reductase family. |
Gene Name : | SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ] |
Official Symbol : | SRD5A2 |
Synonyms : | SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; |
Gene ID : | 6716 |
mRNA Refseq : | NM_000348 |
Protein Refseq : | NP_000339 |
Uniprot ID : | P31213 |
Chromosome Location : | 2p23.1 |
Pathway : | Androgen biosynthesis, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem; |
Function : | 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity; |
Products Types
◆ Recombinant Protein | ||
SRD5A2-5394R | Recombinant Rat SRD5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRD5A2-717C | Recombinant Cynomolgus Monkey SRD5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRD5A2-2100H | Recombinant Human SRD5A2 Protein, His&GST-tagged | +Inquiry |
SRD5A2-8707M | Recombinant Mouse SRD5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRD5A2-4144H | Recombinant Human SRD5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SRD5A2-1480HCL | Recombinant Human SRD5A2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket