Recombinant Human STMN3, His-tagged
Cat.No. : | STMN3-31471TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 27-180 of Human STMN3 with N terminal His tag; 154 amino acids, 25.7kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the stathmin/oncoprotein 18 family of microtubule-destabilizing phosphoproteins. It is similar to the SCG10 protein and is involved in signal transduction and regulation of microtubule dynamics. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 164 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSP ESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVL KQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMEL SKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG |
Gene Name : | STMN3 stathmin-like 3 [ Homo sapiens ] |
Official Symbol : | STMN3 |
Synonyms : | STMN3; stathmin-like 3; stathmin-3; SCLIP; |
Gene ID : | 50861 |
mRNA Refseq : | NM_015894 |
Protein Refseq : | NP_056978 |
MIM : | 608362 |
Uniprot ID : | Q9NZ72 |
Chromosome Location : | 20q13.3 |
Function : | protein domain specific binding; |
Products Types
◆ Recombinant Protein | ||
STMN3-5457R | Recombinant Rat STMN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
STMN3-8816M | Recombinant Mouse STMN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
STMN3-728C | Recombinant Cynomolgus Monkey STMN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
STMN3-1212C | Recombinant Chicken STMN3 | +Inquiry |
STMN3-5798R | Recombinant Rat STMN3 Protein | +Inquiry |
◆ Lysates | ||
STMN3-1395HCL | Recombinant Human STMN3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket