Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SUMO2

Cat.No. : SUMO2-28787TH
Product Overview : Recombinant full length human Sumo 2 ; 95 amino acids, 11 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Source : E. coli
Tissue specificity : Broadly expressed.
Form : Lyophilised
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 1X PBS, pH 7.4
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPL SKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ QQTGGVY.
Sequence Similarities : Belongs to the ubiquitin family. SUMO subfamily.Contains 1 ubiquitin-like domain.
Gene Name : SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol : SUMO2
Synonyms : SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B;
Gene ID : 6613
mRNA Refseq : NM_001005849
Protein Refseq : NP_001005849
MIM : 603042
Uniprot ID : P61956
Chromosome Location : 17q25
Pathway : Glucocorticoid receptor regulatory network, organism-specific biosystem; Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function : protein binding; ubiquitin protein ligase binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends