Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TAC3, His-tagged

Cat.No. : TAC3-29652TH
Product Overview : Recombinant full length Human Neurokinin B with an N terminal His tag; 125 amino acids with a predicted MWt 13.8 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded protein is primarily expressed in the central and peripheral nervous system and functions as a neurotransmitter. This protein is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternate splicing results in multiple transcript variants.
Protein length : 105 amino acids
Conjugation : HIS
Molecular Weight : 13.800kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHQSFGAVCKEPQEEVVPGGGR SKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTS PEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKY PPRAE
Sequence Similarities : Belongs to the tachykinin family.
Gene Name : TAC3 tachykinin 3 [ Homo sapiens ]
Official Symbol : TAC3
Synonyms : TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1;
Gene ID : 6866
mRNA Refseq : NM_001178054
Protein Refseq : NP_001171525
MIM : 162330
Uniprot ID : Q9UHF0
Chromosome Location : 12q13-q21
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem;
Function : receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends