Recombinant Human TAF5L, His-tagged
Cat.No. : | TAF5L-30936TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 349-589 of Human TAF5L with an N terminal His tag. Predicted MWt: 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 73 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVW DLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHL ADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLF TGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTL YKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNT YCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVT GITQENQEH |
Sequence Similarities : | Belongs to the WD repeat TAF5 family.Contains 6 WD repeats. |
Gene Name : | TAF5L TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa [ Homo sapiens ] |
Official Symbol : | TAF5L |
Synonyms : | TAF5L; TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa; TAF5 like RNA polymerase II, p300/CBP associated factor (PCAF) associated factor, 65 kD; TAF5-like RNA polymerase II p300/CBP-associated factor-associated fact |
Gene ID : | 27097 |
mRNA Refseq : | NM_001025247 |
Protein Refseq : | NP_001020418 |
Uniprot ID : | O75529 |
Chromosome Location : | 1q42.11-q42.3 |
Pathway : | Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function : | contributes_to histone acetyltransferase activity; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
TAF5L-8969M | Recombinant Mouse TAF5L Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF5L-4425R | Recombinant Rhesus Macaque TAF5L Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF5L-3549H | Recombinant Human TAF5L protein, GST-tagged | +Inquiry |
TAF5L-10225Z | Recombinant Zebrafish TAF5L | +Inquiry |
TAF5L-4609R | Recombinant Rhesus monkey TAF5L Protein, His-tagged | +Inquiry |
◆ Lysates | ||
TAF5L-1268HCL | Recombinant Human TAF5L 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TAF5L Products
Required fields are marked with *
My Review for All TAF5L Products
Required fields are marked with *
0
Inquiry Basket