Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TANK

Cat.No. : TANK-31443TH
Product Overview : Recombinant fragment of Human TANK , predicted MWt 13.6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length : 119 amino acids
Molecular Weight : 13.600kDa
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituent:0.24% Tris
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQR IREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLE DSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Sequence Similarities : Contains 1 C2H2-type zinc finger.
Gene Name : TANK TRAF family member-associated NFKB activator [ Homo sapiens ]
Official Symbol : TANK
Synonyms : TANK; TRAF family member-associated NFKB activator; TRAF2; TRAF family member-associated NF-kappa-B activator; I TRAF;
Gene ID : 10010
mRNA Refseq : NM_004180
Protein Refseq : NP_004171
MIM : 603893
Uniprot ID : Q92844
Chromosome Location : 2q24-q31
Pathway : Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways, organism-specific biosystem;
Function : metal ion binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All TANK Products

Required fields are marked with *

My Review for All TANK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends