Recombinant Human TAX1BP3, His-tagged
Cat.No. : | TAX1BP3-28609TH |
Product Overview : | Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene. |
Protein length : | 124 amino acids |
Conjugation : | HIS |
Molecular Weight : | 15.800kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS |
Sequence Similarities : | Contains 1 PDZ (DHR) domain. |
Gene Name : | TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ] |
Official Symbol : | TAX1BP3 |
Synonyms : | TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1; |
Gene ID : | 30851 |
mRNA Refseq : | NM_001204698 |
Protein Refseq : | NP_001191627 |
Uniprot ID : | O14907 |
Chromosome Location : | 17p13 |
Pathway : | Wnt Signaling Pathway NetPath, organism-specific biosystem; |
Function : | beta-catenin binding; protein C-terminus binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
TAX1BP3-4444R | Recombinant Rhesus Macaque TAX1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tax1bp3-6300M | Recombinant Mouse Tax1bp3 Protein, Myc/DDK-tagged | +Inquiry |
TAX1BP3-746C | Recombinant Cynomolgus Monkey TAX1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAX1BP3-5624R | Recombinant Rat TAX1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAX1BP3-2158H | Recombinant Human TAX1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
TAX1BP3-1235HCL | Recombinant Human TAX1BP3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket