Recombinant Human TMEM106B Protein, GST-tagged

• Cat.No.: TMEM106B-33H
• Product Overview: Recombinant Human TMEM106B Protein(1-46 aa), fused with GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-46 aa
• AA Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TMEM106B transmembrane protein 106B [ Homo sapiens ]
• Official Symbol: TMEM106B
• Synonyms: TMEM106B; transmembrane protein 106B; FLJ11273; MGC33727
• Gene ID: 54664
• mRNA Refseq: NM_001134232
• Protein Refseq: NP_001127704
• MIM: 613413
• UniProt ID: Q9NUM4