Recombinant Human TMOD3, His-tagged
Cat.No. : | TMOD3-31625TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 81-263 of Human Tropomodulin 3 with an N-terminal His tag; MWt 21 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Tropomodulin-3 is a protein that in humans is encoded by the TMOD3 gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 116 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELE EALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNG VDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKEN DAHLVEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSL AATRSNDPVATAFAEMLKVNKTLKSLNVE |
Sequence Similarities : | Belongs to the tropomodulin family. |
Gene Name : | TMOD3 tropomodulin 3 (ubiquitous) [ Homo sapiens ] |
Official Symbol : | TMOD3 |
Synonyms : | TMOD3; tropomodulin 3 (ubiquitous); tropomodulin-3; UTMOD; |
Gene ID : | 29766 |
mRNA Refseq : | NM_014547 |
Protein Refseq : | NP_055362 |
MIM : | 605112 |
Uniprot ID : | Q9NYL9 |
Chromosome Location : | 15q21.1-q21.2 |
Function : | actin binding; tropomyosin binding; |
Products Types
◆ Recombinant Protein | ||
Tmod3-552M | Recombinant Mouse Tmod3 Protein, His-tagged | +Inquiry |
TMOD3-4666R | Recombinant Rhesus Macaque TMOD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmod3-6524M | Recombinant Mouse Tmod3 Protein, Myc/DDK-tagged | +Inquiry |
TMOD3-4852R | Recombinant Rhesus monkey TMOD3 Protein, His-tagged | +Inquiry |
TMOD3-6959H | Recombinant Human Tropomodulin 3 (ubiquitous), His-tagged | +Inquiry |
◆ Lysates | ||
TMOD3-915HCL | Recombinant Human TMOD3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket