Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TNFSF11 protein, His-tagged

Cat.No. : TNFSF11-1530H
Product Overview : Recombinant Human TNFSF11 protein(O14788)(63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)), fused to N-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
Source : HEK293
Species : Human
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 27.5 kDa
Protein length : 63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
Gene Name : TNFSF11 tumor necrosis factor (ligand) superfamily, member 11 [ Homo sapiens ]
Official Symbol : TNFSF11
Synonyms : TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; CD254; ODF; OPGL; RANKL; TRANCE; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; sOdf; OPTB2; hRANKL2;
Gene ID : 8600
mRNA Refseq : NM_003701
Protein Refseq : NP_003692
MIM : 602642
UniProt ID : O14788

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends