Recombinant Human TNFSF11 protein, His-tagged
Cat.No. : | TNFSF11-1530H |
Product Overview : | Recombinant Human TNFSF11 protein(O14788)(63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)), fused to N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
Source : | HEK293 |
Species : | Human |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.5 kDa |
Protein length : | 63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG) |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
Gene Name : | TNFSF11 tumor necrosis factor (ligand) superfamily, member 11 [ Homo sapiens ] |
Official Symbol : | TNFSF11 |
Synonyms : | TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; CD254; ODF; OPGL; RANKL; TRANCE; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; sOdf; OPTB2; hRANKL2; |
Gene ID : | 8600 |
mRNA Refseq : | NM_003701 |
Protein Refseq : | NP_003692 |
MIM : | 602642 |
UniProt ID : | O14788 |
Products Types
◆ Recombinant Protein | ||
Tnfsf11-85M | Active Recombinant Mouse Tnfsf11 Protein (Pro143-Asp316), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TNFSF11-255M | Active Recombinant Mouse TNFSF11 Protein | +Inquiry |
TNFSF11-683M | Recombinant Mouse TNFSF11 Protein | +Inquiry |
TNFSF11-2025R | Recombinant Rat TNFSF11 Protein | +Inquiry |
TNFSF11-254H | Active Recombinant Human TNFSF11 Protein | +Inquiry |
◆ Lysates | ||
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket