Recombinant Human TOR1A
Cat.No. : | TOR1A-29828TH |
Product Overview : | Recombinant fragment with deletion at aa 303 , of Human Torsin A with N-Terminal proprietary tag.Mol Wt 62.41 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. |
Protein length : | 332 amino acids |
Molecular Weight : | 62.410kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYP RLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKKIIL NAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIY EGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVS ACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHAL SVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC IRVEMQSRGYEIDEDIVSRVAEMTFFPKEERVFSDKGCKT VFTKLDYYYDD |
Gene Name : | TOR1A torsin family 1, member A (torsin A) [ Homo sapiens ] |
Official Symbol : | TOR1A |
Synonyms : | TOR1A; torsin family 1, member A (torsin A); dystonia 1, torsion (autosomal dominant; torsin A) , DYT1; torsin-1A; DQ2; |
Gene ID : | 1861 |
mRNA Refseq : | NM_000113 |
Protein Refseq : | NP_000104 |
MIM : | 605204 |
Uniprot ID : | O14656 |
Chromosome Location : | 9q32-q34 |
Pathway : | Alpha-synuclein signaling, organism-specific biosystem; |
Function : | ATP binding; nucleotide binding; serine-type endopeptidase activity; unfolded protein binding; |
Products Types
◆ Recombinant Protein | ||
Tor1a-543M | Recombinant Mouse Tor1a Protein, His-tagged | +Inquiry |
TOR1A-786C | Recombinant Cynomolgus Monkey TOR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Tor1a-6584M | Recombinant Mouse Tor1a Protein, Myc/DDK-tagged | +Inquiry |
TOR1A-542H | Recombinant Human TOR1A Protein, His-tagged | +Inquiry |
TOR1A-1043C | Recombinant Cynomolgus TOR1A Protein, His-tagged | +Inquiry |
◆ Lysates | ||
TOR1A-866HCL | Recombinant Human TOR1A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TOR1A Products
Required fields are marked with *
My Review for All TOR1A Products
Required fields are marked with *
0
Inquiry Basket