Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TPM3, His-tagged

Cat.No. : TPM3-30392TH
Product Overview : Recombinant full length Human Tropomyosin 3 with N terminal His tag; 272 amino acids with tag, Predicted MWt 31.6 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Mutations in this gene result in autosomal dominant nemaline myopathy, and oncogenes formed by chromosomal translocations involving this locus are associated with cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 248 amino acids
Conjugation : HIS
Molecular Weight : 31.600kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMAGITTIEAVKRKIQV LQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRI QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIEN RALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVII EGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEE KYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKT IDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
Sequence Similarities : Belongs to the tropomyosin family.
Gene Name : TPM3 tropomyosin 3 [ Homo sapiens ]
Official Symbol : TPM3
Synonyms : TPM3; tropomyosin 3; NEM1; tropomyosin alpha-3 chain; TRK;
Gene ID : 7170
mRNA Refseq : NM_001043351
Protein Refseq : NP_001036816
MIM : 191030
Uniprot ID : P06753
Chromosome Location : 1q21.2
Pathway : Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem;
Function : actin binding; molecular_function;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends