Recombinant Human TUFM, His-tagged
Cat.No. : | TUFM-31633TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 211-452 of Human TUFM with an N terminal His tag. Predicted MWt: 28 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVP ARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGD ECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALV RGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILSKEEGGR HKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDL KFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM TEEEKNIKWG |
Gene Name : | TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ] |
Official Symbol : | TUFM |
Synonyms : | TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU; |
Gene ID : | 7284 |
mRNA Refseq : | NM_003321 |
Protein Refseq : | NP_003312 |
MIM : | 602389 |
Uniprot ID : | P49411 |
Chromosome Location : | 16p11.2 |
Function : | GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity; |
Products Types
◆ Recombinant Protein | ||
TUFM-6022R | Recombinant Rat TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
TUFM-1189H | Recombinant Human TUFM Protein (46-290 aa), His-tagged | +Inquiry |
TUFM-4841R | Recombinant Rhesus Macaque TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
TUFM-845H | Recombinant Human TUFM Protein (44-452 aa), His-SUMO-tagged | +Inquiry |
TUFM-9768M | Recombinant Mouse TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TUFM Products
Required fields are marked with *
My Review for All TUFM Products
Required fields are marked with *
0
Inquiry Basket