Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human UBE2D3

Cat.No. : UBE2D3-30045TH
Product Overview : Recombinant Full Length Human UBE2D3 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-147; 147 amino acids, 16.7kDa,
  • Specification
  • Gene Information
  • Related Products
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGP NDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPD DPLVPEIARIYKTDRDKYNRISREWTQKYAM
Sequence Similarities : Belongs to the ubiquitin-conjugating enzyme family.
Gene Name : UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ]
Official Symbol : UBE2D3
Synonyms : UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C;
Gene ID : 7323
mRNA Refseq : NM_003340
Protein Refseq : NP_003331
MIM : 602963
Uniprot ID : P61077
Chromosome Location : 4q24
Pathway : Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem;
Function : ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends