Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human VAC14, His-tagged

Cat.No. : VAC14-29818TH
Product Overview : Recombinant fragment, corresponding to amino acids 640-782 of Human VAC14 with N terminal His tag; 143 amino acids, 18kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The content of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) in endosomal membranes changes dynamically with fission and fusion events that generate or absorb intracellular transport vesicles. VAC14 is a component of a trimolecular complex that tightly regulates the level of PtdIns(3,5)P2. Other components of this complex are the PtdIns(3,5)P2-synthesizing enzyme PIKFYVE (MIM 609414) and the PtdIns(3,5)P2 phosphatase FIG4 (MIM 609390). VAC14 functions as an activator of PIKFYVE (Sbrissa et al.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitously expressed.
Form : Lyophilised:Reconstitute with 82 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QNYRHAYDLIQKFGDLEVTVDFLAEVDKLVQLIECPIFTY LRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRL QCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHF EKVQNKHLEVRHQRSGRGDHLDRRVVL
Sequence Similarities : Belongs to the VAC14 family.Contains 6 HEAT repeats.
Gene Name : VAC14 Vac14 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : VAC14
Synonyms : VAC14; Vac14 homolog (S. cerevisiae); Tax1 (human T cell leukemia virus type I) binding protein 2 , TAX1BP2; protein VAC14 homolog; ArPIKfyve; FLJ10305;
Gene ID : 55697
mRNA Refseq : NM_018052
Protein Refseq : NP_060522
MIM : 604632
Uniprot ID : Q08AM6
Chromosome Location : 16q22.1
Pathway : HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function : binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends