Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human VAPA, His-tagged

Cat.No. : VAPA-30991TH
Product Overview : Recombinant fragment of Human VAPA with a 37aa N terminal His tag; 264aa, 29.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Protein length : 227 amino acids
Conjugation : HIS
Molecular Weight : 29.800kDa inclusive of tags
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris, 0.02% DTT, 10% Glycerol
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMASA SGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSD RKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFD YDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDS KLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHS VSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLR KVAHSDKPGSTSTASFRDNVTSP
Sequence Similarities : Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family.Contains 1 MSP domain.
Gene Name : VAPA VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa [ Homo sapiens ]
Official Symbol : VAPA
Synonyms : VAPA; VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa; VAMP (vesicle associated membrane protein) associated protein A (33kD); vesicle-associated membrane protein-associated protein A; hVAP 33; VAP A;
Gene ID : 9218
mRNA Refseq : NM_003574
Protein Refseq : NP_003565
MIM : 605703
Uniprot ID : Q9P0L0
Chromosome Location : 18p11.2
Pathway : Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Tight junction, organism-specific biosystem; Tight junction, conserved biosystem;
Function : protein binding; protein heterodimerization activity; signal transducer activity; structural molecule activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All VAPA Products

Required fields are marked with *

My Review for All VAPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends