Recombinant Human VAPA, His-tagged
Cat.No. : | VAPA-30991TH |
Product Overview : | Recombinant fragment of Human VAPA with a 37aa N terminal His tag; 264aa, 29.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
Protein length : | 227 amino acids |
Conjugation : | HIS |
Molecular Weight : | 29.800kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris, 0.02% DTT, 10% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMASA SGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSD RKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFD YDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDS KLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHS VSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLR KVAHSDKPGSTSTASFRDNVTSP |
Sequence Similarities : | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family.Contains 1 MSP domain. |
Gene Name : | VAPA VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa [ Homo sapiens ] |
Official Symbol : | VAPA |
Synonyms : | VAPA; VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa; VAMP (vesicle associated membrane protein) associated protein A (33kD); vesicle-associated membrane protein-associated protein A; hVAP 33; VAP A; |
Gene ID : | 9218 |
mRNA Refseq : | NM_003574 |
Protein Refseq : | NP_003565 |
MIM : | 605703 |
Uniprot ID : | Q9P0L0 |
Chromosome Location : | 18p11.2 |
Pathway : | Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; |
Function : | protein binding; protein heterodimerization activity; signal transducer activity; structural molecule activity; |
Products Types
◆ Recombinant Protein | ||
VAPA-9994M | Recombinant Mouse VAPA Protein, His (Fc)-Avi-tagged | +Inquiry |
VAPA-6154R | Recombinant Rat VAPA Protein, His (Fc)-Avi-tagged | +Inquiry |
VAPA-287H | Recombinant Human VAPA Protein, His-tagged | +Inquiry |
Vapa-6896M | Recombinant Mouse Vapa Protein, Myc/DDK-tagged | +Inquiry |
VAPA-3645H | Recombinant Human VAPA, GST-tagged | +Inquiry |
◆ Lysates | ||
VAPA-431HCL | Recombinant Human VAPA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All VAPA Products
Required fields are marked with *
My Review for All VAPA Products
Required fields are marked with *
0
Inquiry Basket