Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ZDHHC8 Protein (1-42), N-GST tagged

Cat.No. : ZDHHC8-01H
Product Overview : Human ZDHHC8 full-length ORF ( AAH09442, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophrenia. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 22.
Source : Wheat Germ (in vitro)
Species : Human
Tag : N-GST
Molecular Mass : 30.36 kDa
Protein Length : 1-42
AA Sequence : MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : ZDHHC8 zinc finger DHHC-type palmitoyltransferase 8 [ Homo sapiens (human) ]
Official Symbol : ZDHHC8
Synonyms : ZDHHC8; zinc finger DHHC-type palmitoyltransferase 8; DHHC8; ZNF378; ZDHHCL1; palmitoyltransferase ZDHHC8; membrane-associated DHHC8 zinc finger protein; zinc finger DHHC-type containing 8; zinc finger protein 378; zinc finger, DHHC domain like containing 1; EC 2.3.1.225
Gene ID : 29801
mRNA Refseq : NM_013373
Protein Refseq : NP_037505
MIM : 608784
UniProt ID : Q2TGE9

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All ZDHHC8 Products

Required fields are marked with *

My Review for All ZDHHC8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends