Recombinant Human ZNF131, His-tagged
Cat.No. : | ZNF131-30754TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 444-589 of Human ZNF131 Isoform 2 with N terminal His tag;Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Predominant expression is found in different brain areas such as the occipital and temporal lobe, the nucleus caudatus, hippocampus, and the cerebellum as well as in testis and thymus. |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSHMSELP EQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEV QTELLEADLDHVTPEIMNQEERESSQADAAEAAREDHE DAEDLETKPTVDSEAEKAENEDRTALPVLE |
Sequence Similarities : | Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 1 BTB (POZ) domain.Contains 6 C2H2-type zinc fingers. |
Gene Name : | ZNF131 zinc finger protein 131 [ Homo sapiens ] |
Official Symbol : | ZNF131 |
Synonyms : | ZNF131; zinc finger protein 131; zinc finger protein 131 (clone pHZ 10); pHZ 10; |
Gene ID : | 7690 |
mRNA Refseq : | NM_003432 |
Protein Refseq : | NP_003423 |
MIM : | 604073 |
Uniprot ID : | P52739 |
Chromosome Location : | 5p12 |
Function : | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
ZNF131-10398M | Recombinant Mouse ZNF131 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF131-10799Z | Recombinant Zebrafish ZNF131 | +Inquiry |
ZFP131-18830M | Recombinant Mouse ZFP131 Protein | +Inquiry |
◆ Lysates | ||
ZNF131-1985HCL | Recombinant Human ZNF131 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket