Recombinant Human ZNHIT1, His-tagged
Cat.No. : | ZNHIT1-31745TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-154 of Human ZNHIT1 with N terminal His tag; Predicted MWt 19kDa. |
- Specification
- Gene Information
- Related Products
Description : | ZNHIT1, Zinc finger HIT domain containing protein 1, appears to play a role in p53-mediated apoptosis induction. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 111 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNF QDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKL RFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPF CAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV |
Gene Name : | ZNHIT1 zinc finger, HIT-type containing 1 [ Homo sapiens ] |
Official Symbol : | ZNHIT1 |
Synonyms : | ZNHIT1; zinc finger, HIT-type containing 1; zinc finger protein, subfamily 4A (HIT domain containing), member 1 , zinc finger, HIT domain containing 1 , ZNFN4A1; zinc finger HIT domain-containing protein 1; CG1I; H_DJ0747G18.14; putative cyclin G1 intera |
Gene ID : | 10467 |
mRNA Refseq : | NM_006349 |
Protein Refseq : | NP_006340 |
Uniprot ID : | O43257 |
Chromosome Location : | 7q22.1 |
Function : | metal ion binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
ZNHIT1-5180R | Recombinant Rhesus Macaque ZNHIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNHIT1-840H | Recombinant Human ZNHIT1 Protein, His-tagged | +Inquiry |
ZNHIT1-134H | Recombinant Human ZNHIT1, His-tagged | +Inquiry |
ZNHIT1-5367R | Recombinant Rhesus monkey ZNHIT1 Protein, His-tagged | +Inquiry |
ZNHIT1-2320Z | Recombinant Zebrafish ZNHIT1 | +Inquiry |
◆ Lysates | ||
ZNHIT1-2095HCL | Recombinant Human ZNHIT1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket