Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Mouse DEFB33 Protein (21-62 aa), His-SUMO-Myc-tagged

Cat.No. : DEFB33-2620M
Product Overview : Recombinant Mouse DEFB33 Protein (21-62 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Mouse
Tag : His-SUMO-Myc
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.9 kDa
Protein length : 21-62 aa
AA Sequence : RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name : Defb33 defensin beta 33 [ Mus musculus (house mouse) ]
Official Symbol : DEFB33
Synonyms : Defb33; BD-33; EG654453;
Gene ID : 654453
mRNA Refseq : NM_001039119
Protein Refseq : NP_001034208
UniProt ID : Q30KN3

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DEFB33 Products

Required fields are marked with *

My Review for All DEFB33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends