Recombinant Mouse FPR1 Protein (1-35 aa), His-GST-Myc-tagged
Cat.No. : | FPR1-2444M |
Product Overview : | Recombinant Mouse FPR1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Description : | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. |
Source : | E. coli |
Species : | Mouse |
Tag : | His-GST-Myc |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.7 kDa |
Protein length : | 1-35 aa |
AA Sequence : | MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name : | Fpr1 formyl peptide receptor 1 [ Mus musculus ] |
Official Symbol : | FPR1 |
Synonyms : | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; fMLP receptor; lipoxin A4 receptor; FPR; LXA4R; fMLF-R; |
Gene ID : | 14293 |
mRNA Refseq : | NM_013521 |
Protein Refseq : | NP_038549 |
UniProt ID : | P33766 |
Products Types
◆ Recombinant Protein | ||
FPR1-2489H | Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged | +Inquiry |
FPR1-1524H | Recombinant Human FPR1 Protein, His&GST-tagged | +Inquiry |
FPR1-3346M | Recombinant Mouse FPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FPR1-2994H | Recombinant Human FPR1 protein, His-tagged | +Inquiry |
FPR1-2882H | Recombinant Human FPR1 Protein (Arg163-Val242), N-GST tagged | +Inquiry |
◆ Assay kits | ||
Kit-1238 | FPR1 CHO-K1 β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1239 | FPR1 Total GPCR Internalization Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket