Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Rhesus Macaque S100 Calcium Binding Protein B

Cat.No. : S100B-5482R
Product Overview : Recombinant Rhesusmacaque S100 calcium binding protein B is a single, non-glycosylatedpolypeptide chain containing 92 amino acids.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : S100B-5482R
Description : S100B isglial-specific and is expressed primarily by astrocytes. Not all astrocytes expressS100B. It has been shown that S100B is only expressed by a subtype of mature astrocytesthat ensheath blood vessels and by NG2-expressing cells. This protein mayfunction in neurite extension,proliferation of melanoma cells, stimulation ofCa2+ fluxes,inhibition of PKC-mediatedphosphorylation,astrocytosis and axonal proliferation, and inhibition ofmicrotubule assembly. In the developing CNS, it acts as a neurotrophic factorand neuronal survival protein.
Source : E. coli
Species : Rhesus Macaque
Form : Lyophilized from a0.2μm filtered concentrated solution in PBS, pH 7.4.
Purity : >97%by SDS-PAGEand HPLC analyses
Endotoxin Level : <0.1 ng/μg ofprotein.
Amino Acid Sequence : MSELEKAMVALIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKEQEVVDKVMETLDSDGDGECD FQEFMAFVAM VTTACHEFFE HE
Molecular Weight : 10.7 kDa
Reconstitution : Centrifuge vialprior to opening.Reconstitute in sterile distilled water or aqueous buffercontaining 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutionsshould be divided into working aliquots and stored at -80°C. Furtherdilutions should be made in appropriate buffered solutions.
Storage : The lyophilizedprotein is stable at 2-4°C, but should be kept desiccated at -20°C for long termstorage. After reconstitution, the protein is stable for 1 week at 2-4°C. Forlong term storage, aliquot and freeze at -80°C. Avoid repeated freeze-thawcycles.
OfficialSymbol : S100B
Gene Name : S100B S100 calcium bindingprotein B [ Macaca mulatta ]
Synonyms : S100B;S100 calcium binding protein B
Gene ID : 708117
mRNA Refseq : XM_001098016
Protein Refseq : XP_001098016
UniProt ID : F7ANQ9

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends