Recombinant Sheep GHRH Protein (1-44 aa), GST-tagged
Cat.No. : | GHRH-523S |
Product Overview : | Recombinant Sheep GHRH Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
Description : | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. |
Source : | E. coli |
Species : | Sheep |
Tag : | GST |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 32.1 kDa |
Protein length : | 1-44 aa |
AA Sequence : | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name : | GHRH growth hormone releasing hormone [ Ovis aries (sheep) ] |
Official Symbol : | GHRH |
Synonyms : | GRF; |
Gene ID : | 100101237 |
UniProt ID : | P07217 |
Products Types
◆ Recombinant Protein | ||
GHRH-3550M | Recombinant Mouse GHRH Protein, His (Fc)-Avi-tagged | +Inquiry |
GHRH-4888H | Recombinant Human GHRH Protein, GST-tagged | +Inquiry |
GHRH-2185R | Recombinant Rat GHRH Protein, His (Fc)-Avi-tagged | +Inquiry |
GHRH-3413C | Recombinant Chicken GHRH | +Inquiry |
GHRH-2868H | Recombinant Human GHRH Protein (Pro21-Leu75), C-Fc tagged | +Inquiry |
◆ Native Protein | ||
GHRH-37H | Active Native Human GHRH | +Inquiry |
◆ Lysates | ||
GHRH-704HCL | Recombinant Human GHRH cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket