Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Sheep GHRH Protein (1-44 aa), GST-tagged

Cat.No. : GHRH-523S
Product Overview : Recombinant Sheep GHRH Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
Description : GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Source : E. coli
Species : Sheep
Tag : GST
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 32.1 kDa
Protein length : 1-44 aa
AA Sequence : YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name : GHRH growth hormone releasing hormone [ Ovis aries (sheep) ]
Official Symbol : GHRH
Synonyms : GRF;
Gene ID : 100101237
UniProt ID : P07217

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends