Synthesized Human B-type Natriuretic Peptide

• Cat.No.: NPPB-1857H
• Product Overview: B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.

Specification

• Description: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized without additives.
• AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
• Purity: Greater than 95.0% as determined by RP-HPLC.
• Storage: Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
• Reconstitution: It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860
• Chromosome Location: 1p36.2
• Pathway: MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding

Reviews

06/17/2022

They actively engage with researchers, comprehending their specific experimental needs, and offering tailored services accordingly.

01/16/2022

This collaborative partnership facilitates a seamless and efficient research process, as the manufacturer aligns their support and services with my unique requirements.

12/09/2019

The manufacturer's excellent technical support, commitment to innovation, and customer-centric approach further reinforce its suitability for my research.

Q&As

In what ways does NPPB protein contribute to the understanding of fluid overload in patients?

Elevated NPPB levels are associated with fluid overload, providing valuable information for clinicians in managing patients with conditions like edema.

Can NPPB protein be used in monitoring the efficacy of treatments for cardiovascular diseases?

Yes, monitoring NPPB levels over time can help assess the effectiveness of treatments and interventions in managing cardiovascular conditions.

How do age and gender influence the normal range of NPPB protein levels in healthy individuals?

Normal ranges of NPPB may vary with age and gender. Understanding these variations is essential for accurate clinical interpretation.

Are there any specific contraindications or limitations in using NPPB protein as a clinical marker?

While NPPB is a valuable marker, clinicians should consider factors like renal function and comorbidities that may affect its interpretation.

How does NPPB protein influence the management of hypertension in clinical practice?

NPPB regulates blood pressure by promoting vasodilation and natriuresis. Understanding its levels can guide the management of hypertension.