"WTAP" Related Products

Expand
Expand

Recombinant Human WTAP protein, T7-tagged

Cat.No.: WTAP-186H
Product Overview: Recombinant human WTAP (151aa, Isoform-II) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKL EQAQNELSAWKFTPDR
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: WTAP Wilms tumor 1 associated protein [ Homo sapiens ]
Official Symbol: WTAP
Synonyms: WTAP; Wilms tumor 1 associated protein; pre-mRNA-splicing regulator WTAP; KIAA0105; MGC3925; hFL(2)D; PNAS-132; WT1-associated protein; female-lethal(2)D homolog; wilms tumor 1-associating protein; Wilms tumour 1-associating protein; putative pre-mRNA splicing regulator female-lethal(2D); DKFZp686F20131;
Gene ID: 9589
mRNA Refseq: NM_004906
Protein Refseq: NP_004897
MIM: 605442
UniProt ID: Q15007
Chromosome Location: 6q25-q27

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.