"AKAP7" Related Products

Expand

Recombinant Human AKAP7

Cat.No.: AKAP7-26524TH
Product Overview: Recombinant full length Human AKAP7 produced in Saccharomyces cerevisiae; amino acids 1-81; 81 amino acids, 8.9kDa. Protein has a 26 kDa proprietary tag.
Description: This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
Tissue specificity: Expressed in brain, heart, lung, pancreas and skeletal muscle.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENA VLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNEN NRK
Gene Name: AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ]
Official Symbol: AKAP7
Synonyms: AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18;
Gene ID: 9465
mRNA Refseq: NM_004842
Protein Refseq: NP_004833
MIM: 604693
Uniprot ID: O43687
Chromosome Location: 6q22-q24
Pathway: G Protein Signaling Pathways, organism-specific biosystem;
Function: AMP binding; catalytic activity; protein C-terminus binding; protein complex scaffold; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.