Recombinant Human ARAP1, His-tagged
Cat.No. : | ARAP1-26993TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 757-1133 of Human ARAP1 with an N terminal His tag. Observed mwt: 44 kDa ; accession number: AAI40793. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activity. The encoded protein associates with the Golgi, and the ARF-GAP activity mediates changes in the Golgi and the formation of filopodia. It is thought to regulate the cell-specific trafficking of a receptor protein involved in apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea. |
Form : | Lyophilised:Reconstitution with 143 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMN VHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTV YLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKD YWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVV KKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGL PSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLK VYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQME LREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVS LIPLRGSENEMRRSVAAFTADPLSLLRNV |
Sequence Similarities : | Contains 1 Arf-GAP domain.Contains 4 PH domains.Contains 1 Ras-associating domain.Contains 1 Rho-GAP domain.Contains 1 SAM (sterile alpha motif) domain. |
Gene Name : | ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [ Homo sapiens ] |
Official Symbol : | ARAP1 |
Synonyms : | ARAP1; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1; centaurin, delta 2 , CENTD2; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1; |
Gene ID : | 116985 |
mRNA Refseq : | NM_001040118 |
Protein Refseq : | NP_001035207 |
MIM : | 606646 |
Uniprot ID : | Q96P48 |
Chromosome Location : | 11q13.3 |
Pathway : | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
Function : | ARF GTPase activator activity; Rho GTPase activator activity; metal ion binding; phosphatidylinositol-3,4,5-trisphosphate binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
ARAP1-655M | Recombinant Mouse ARAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARAP1-1832M | Recombinant Mouse ARAP1 Protein | +Inquiry |
ARAP1-32H | Recombinant Human ARAP1 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
ARAP1-337HCL | Recombinant Human ARAP1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (22)
Ask a questionThe potential of the ARAP1 protein as a diagnostic marker for specific diseases is still being investigated. While altered ARAP1 expression has been observed in certain diseases, further research is needed to validate its utility as a diagnostic marker in clinical settings.
Yes, mutations or genetic variations in the ARAP1 gene have been linked to certain diseases. For example, a rare mutation in the ARAP1 gene has been associated with intellectual disability and developmental delay in some individuals.
Dysregulation of the ARAP1 protein has been implicated in various diseases, including cancer, cardiovascular disorders, and neurodevelopmental disorders. Altered ARAP1 expression or activity can contribute to disease progression by influencing cellular processes such as migration, invasion, and signaling pathways.
Yes, studies suggest that the ARAP1 protein plays a role in cancer metastasis. It has been associated with increased cell migration and invasion, processes crucial for tumor metastasis. Dysregulation of ARAP1 expression or activity has been observed in various cancer types, indicating its potential involvement in cancer progression and metastasis.
Emerging evidence suggests that the ARAP1 protein may play a role in neuronal development and function. It has been implicated in neurite outgrowth, axon guidance, and synaptic plasticity, suggesting its involvement in neuronal processes. However, more research is needed to fully understand its specific contributions in this context.
Targeting the ARAP1 protein holds therapeutic potential in various diseases. Since ARAP1 is implicated in cancer metastasis, inhibiting its activity may help prevent or impede tumor spread. Additionally, as ARAP1 is involved in insulin signaling and glucose metabolism, modulating its activity could be beneficial in the treatment of insulin resistance and type 2 diabetes. Given its role in vascular biology, targeting ARAP1 may also have implications in angiogenesis-related disorders or cardiovascular diseases.
While the ARAP1 protein has been implicated in various diseases, its use as a diagnostic or prognostic marker is not yet established. Further research is needed to determine the clinical utility of ARAP1 protein levels or activity as a biomarker for specific diseases.
The ARAP1 protein's involvement in angiogenesis suggests its potential as a target for anti-angiogenesis therapy. Modulating ARAP1 activity may have implications in inhibiting excessive blood vessel formation in diseases such as cancer or age-related macular degeneration. However, more research is needed to fully understand ARAP1's role in angiogenesis and its therapeutic potential.
The ARAP1 protein can interact with a range of proteins to form complexes that mediate its functions. Some known interacting partners include proteins involved in endocytic pathways, such as clathrin and AP2, as well as signaling molecules like PI3K and GTPases. These interactions help regulate cellular processes and signal transduction.
Yes, the ARAP1 protein consists of several functional domains. It has an ankyrin repeat domain, which is involved in protein-protein interactions, a PH (pleckstrin homology) domain that binds to phosphoinositides, a RhoGAP domain that regulates Rho GTPases, and an ArfGAP domain that activates Arf GTPases. These domains contribute to the diverse functions of ARAP1.
Yes, the ARAP1 protein has been implicated in vascular biology. It has been shown to regulate endothelial cell migration and angiogenesis, the process of new blood vessel formation. ARAP1's interaction with signaling molecules involved in vascular biology suggests its influence on endothelial cell function and blood vessel development.
Yes, the ARAP1 protein can interact with and modulate the activity of various membrane receptors. For example, it has been shown to interact with the platelet-derived growth factor receptor (PDGFR), insulin receptor, and epidermal growth factor receptor (EGFR). These interactions can impact downstream signaling pathways and cellular responses.
The role of ARAP1 in neurodegenerative diseases is not well-studied currently. While there is limited research suggesting potential involvement of ARAP1 in neurodegenerative diseases like Alzheimer's disease, more studies are required to elucidate its precise function and contribution in these conditions.
Yes, the ARAP1 protein is involved in several cellular processes and functions. Apart from its roles in cell migration, angiogenesis, and insulin signaling, ARAP1 has been implicated in receptor recycling, endocytosis, and cytoskeletal organization. It also interacts with other signaling molecules to modulate diverse cellular processes.
Yes, the ARAP1 protein has been implicated in immune cell function. It is believed to play a role in regulating immune cell adhesion, migration, and activation by modulating signaling pathways and cytoskeletal rearrangements.
Yes, mutations and polymorphisms in the ARAP1 gene have been reported. Some genetic variations in ARAP1 have been associated with an increased risk of certain cardiovascular diseases, such as coronary artery disease. Further studies are needed to determine the functional consequences of these genetic alterations and their impact on ARAP1 protein function.
While specific inhibitors or activators of the ARAP1 protein are yet to be developed, certain compounds or molecules targeting upstream or downstream components of the ARAP1 signaling pathway may indirectly modulate ARAP1 activity. Further research is necessary to identify and develop specific modulators of ARAP1 function.
While direct targeting of the ARAP1 protein for therapeutic interventions is currently limited, understanding its role in disease pathways can provide insights for potential therapeutic strategies. Modulating ARAP1-regulated signaling pathways or targeting downstream effectors may hold therapeutic promise for certain diseases.
Yes, there are several known interacting proteins of ARAP1. These include Rho and Arf GTPases, which regulate ARAP1's activity, as well as various membrane receptors such as PDGFR, insulin receptor, and EGFR. Additionally, ARAP1 can interact with other signaling molecules and adaptor proteins, allowing it to participate in different cellular processes and signaling pathways.
Yes, studies have shown that the ARAP1 protein can modulate insulin signaling. It has been implicated in the regulation of insulin-stimulated glucose uptake and insulin receptor signaling in adipocytes and skeletal muscle cells. Dysregulation of ARAP1 activity may impact insulin sensitivity and glucose metabolism, potentially contributing to insulin resistance.
Yes, the ARAP1 protein can be a potential target for drug development. Its involvement in different diseases and cellular processes makes it an attractive target for therapeutic intervention. However, further research is needed to better understand the precise mechanisms underlying ARAP1 function and to develop specific modulators of its activity.
Yes, the expression of the ARAP1 protein can be altered under certain conditions. For instance, changes in ARAP1 expression have been observed during embryonic development, neuronal differentiation, and in various disease contexts, including cancer and cardiovascular diseases. Understanding these alterations in expression can help decipher its role in specific physiological or pathological processes.
Customer Reviews (8)
Write a reviewWhether I am studying protein interactions, cellular localization, or signaling pathways, the ARAP1 protein consistently delivers reliable and reproducible data, enabling significant scientific advancements.
Its superior purity and stability ensure reliable and accurate results, instilling confidence in my research.
the ARAP1 protein's compatibility with various experimental techniques further supports its usability.
Their assistance has been invaluable in streamlining my experiments and overcoming obstacles effectively.
Its versatility and reliability make it a great choice for researchers exploring protein dynamics, function, and interactions.
ts reliability and high quality make it a valuable tool in various applications, ranging from enzymatic assays to studying protein-protein interactions.
Its use in EM studies allows researchers to gain insights into the structural details of proteins and their complexes at high resolution.
the ARAP1 protein is highly regarded for its excellent performance in WB assays and its significant contribution to protein EM structure analysis.
Ask a Question for All ARAP1 Products
Required fields are marked with *
My Review for All ARAP1 Products
Required fields are marked with *
Inquiry Basket