Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ARAP1, His-tagged

Cat.No. : ARAP1-26993TH
Product Overview : Recombinant fragment, corresponding to amino acids 757-1133 of Human ARAP1 with an N terminal His tag. Observed mwt: 44 kDa ; accession number: AAI40793.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activity. The encoded protein associates with the Golgi, and the ARF-GAP activity mediates changes in the Golgi and the formation of filopodia. It is thought to regulate the cell-specific trafficking of a receptor protein involved in apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea.
Form : Lyophilised:Reconstitution with 143 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMN VHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTV YLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKD YWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVV KKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGL PSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLK VYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQME LREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVS LIPLRGSENEMRRSVAAFTADPLSLLRNV
Sequence Similarities : Contains 1 Arf-GAP domain.Contains 4 PH domains.Contains 1 Ras-associating domain.Contains 1 Rho-GAP domain.Contains 1 SAM (sterile alpha motif) domain.
Gene Name : ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol : ARAP1
Synonyms : ARAP1; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1; centaurin, delta 2 , CENTD2; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1;
Gene ID : 116985
mRNA Refseq : NM_001040118
Protein Refseq : NP_001035207
MIM : 606646
Uniprot ID : Q96P48
Chromosome Location : 11q13.3
Pathway : Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function : ARF GTPase activator activity; Rho GTPase activator activity; metal ion binding; phosphatidylinositol-3,4,5-trisphosphate binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (22)

Ask a question
Can the ARAP1 protein be used as a diagnostic marker for any diseases? 02/12/2023

The potential of the ARAP1 protein as a diagnostic marker for specific diseases is still being investigated. While altered ARAP1 expression has been observed in certain diseases, further research is needed to validate its utility as a diagnostic marker in clinical settings.

Are there any genetic variations or mutations in the ARAP1 gene associated with human diseases? 12/04/2022

Yes, mutations or genetic variations in the ARAP1 gene have been linked to certain diseases. For example, a rare mutation in the ARAP1 gene has been associated with intellectual disability and developmental delay in some individuals.

Is the ARAP1 protein associated with any diseases? 09/29/2022

Dysregulation of the ARAP1 protein has been implicated in various diseases, including cancer, cardiovascular disorders, and neurodevelopmental disorders. Altered ARAP1 expression or activity can contribute to disease progression by influencing cellular processes such as migration, invasion, and signaling pathways.

Is the ARAP1 protein involved in cancer metastasis? 09/27/2022

Yes, studies suggest that the ARAP1 protein plays a role in cancer metastasis. It has been associated with increased cell migration and invasion, processes crucial for tumor metastasis. Dysregulation of ARAP1 expression or activity has been observed in various cancer types, indicating its potential involvement in cancer progression and metastasis.

Does the ARAP1 protein have any role in neuronal development or function? 08/09/2022

Emerging evidence suggests that the ARAP1 protein may play a role in neuronal development and function. It has been implicated in neurite outgrowth, axon guidance, and synaptic plasticity, suggesting its involvement in neuronal processes. However, more research is needed to fully understand its specific contributions in this context.

What are the potential therapeutic implications of targeting the ARAP1 protein? 08/19/2021

Targeting the ARAP1 protein holds therapeutic potential in various diseases. Since ARAP1 is implicated in cancer metastasis, inhibiting its activity may help prevent or impede tumor spread. Additionally, as ARAP1 is involved in insulin signaling and glucose metabolism, modulating its activity could be beneficial in the treatment of insulin resistance and type 2 diabetes. Given its role in vascular biology, targeting ARAP1 may also have implications in angiogenesis-related disorders or cardiovascular diseases.

Can the ARAP1 protein be used as a diagnostic or prognostic marker in any diseases? 04/11/2021

While the ARAP1 protein has been implicated in various diseases, its use as a diagnostic or prognostic marker is not yet established. Further research is needed to determine the clinical utility of ARAP1 protein levels or activity as a biomarker for specific diseases.

Can the ARAP1 protein function as a potential drug target for anti-angiogenesis therapy? 03/16/2021

The ARAP1 protein's involvement in angiogenesis suggests its potential as a target for anti-angiogenesis therapy. Modulating ARAP1 activity may have implications in inhibiting excessive blood vessel formation in diseases such as cancer or age-related macular degeneration. However, more research is needed to fully understand ARAP1's role in angiogenesis and its therapeutic potential.

Are there any known interacting partners of the ARAP1 protein? 02/05/2021

The ARAP1 protein can interact with a range of proteins to form complexes that mediate its functions. Some known interacting partners include proteins involved in endocytic pathways, such as clathrin and AP2, as well as signaling molecules like PI3K and GTPases. These interactions help regulate cellular processes and signal transduction.

Are there any known functional domains within the ARAP1 protein? 03/25/2020

Yes, the ARAP1 protein consists of several functional domains. It has an ankyrin repeat domain, which is involved in protein-protein interactions, a PH (pleckstrin homology) domain that binds to phosphoinositides, a RhoGAP domain that regulates Rho GTPases, and an ArfGAP domain that activates Arf GTPases. These domains contribute to the diverse functions of ARAP1.

Does the ARAP1 protein have any role in vascular biology? 12/07/2018

Yes, the ARAP1 protein has been implicated in vascular biology. It has been shown to regulate endothelial cell migration and angiogenesis, the process of new blood vessel formation. ARAP1's interaction with signaling molecules involved in vascular biology suggests its influence on endothelial cell function and blood vessel development.

Can the ARAP1 protein interact with membrane receptors? 11/09/2018

Yes, the ARAP1 protein can interact with and modulate the activity of various membrane receptors. For example, it has been shown to interact with the platelet-derived growth factor receptor (PDGFR), insulin receptor, and epidermal growth factor receptor (EGFR). These interactions can impact downstream signaling pathways and cellular responses.

Are there any studies investigating the role of ARAP1 in neurodegenerative diseases? 10/26/2018

The role of ARAP1 in neurodegenerative diseases is not well-studied currently. While there is limited research suggesting potential involvement of ARAP1 in neurodegenerative diseases like Alzheimer's disease, more studies are required to elucidate its precise function and contribution in these conditions.

Is the ARAP1 protein involved in any other cellular processes or functions? 07/03/2018

Yes, the ARAP1 protein is involved in several cellular processes and functions. Apart from its roles in cell migration, angiogenesis, and insulin signaling, ARAP1 has been implicated in receptor recycling, endocytosis, and cytoskeletal organization. It also interacts with other signaling molecules to modulate diverse cellular processes.

Is the ARAP1 protein involved in immune cell function? 05/27/2018

Yes, the ARAP1 protein has been implicated in immune cell function. It is believed to play a role in regulating immune cell adhesion, migration, and activation by modulating signaling pathways and cytoskeletal rearrangements.

Are there any known genetic mutations or polymorphisms in the ARAP1 gene? 09/05/2017

Yes, mutations and polymorphisms in the ARAP1 gene have been reported. Some genetic variations in ARAP1 have been associated with an increased risk of certain cardiovascular diseases, such as coronary artery disease. Further studies are needed to determine the functional consequences of these genetic alterations and their impact on ARAP1 protein function.

Are there any known inhibitors or activators of the ARAP1 protein? 06/02/2016

While specific inhibitors or activators of the ARAP1 protein are yet to be developed, certain compounds or molecules targeting upstream or downstream components of the ARAP1 signaling pathway may indirectly modulate ARAP1 activity. Further research is necessary to identify and develop specific modulators of ARAP1 function.

Can the ARAP1 protein be targeted for therapeutic interventions? 05/12/2016

While direct targeting of the ARAP1 protein for therapeutic interventions is currently limited, understanding its role in disease pathways can provide insights for potential therapeutic strategies. Modulating ARAP1-regulated signaling pathways or targeting downstream effectors may hold therapeutic promise for certain diseases.

Are there any known interacting proteins of ARAP1? 04/10/2016

Yes, there are several known interacting proteins of ARAP1. These include Rho and Arf GTPases, which regulate ARAP1's activity, as well as various membrane receptors such as PDGFR, insulin receptor, and EGFR. Additionally, ARAP1 can interact with other signaling molecules and adaptor proteins, allowing it to participate in different cellular processes and signaling pathways.

Does the ARAP1 protein have any role in insulin signaling? 04/03/2016

Yes, studies have shown that the ARAP1 protein can modulate insulin signaling. It has been implicated in the regulation of insulin-stimulated glucose uptake and insulin receptor signaling in adipocytes and skeletal muscle cells. Dysregulation of ARAP1 activity may impact insulin sensitivity and glucose metabolism, potentially contributing to insulin resistance.

Can the ARAP1 protein be targeted for drug development? 03/24/2016

Yes, the ARAP1 protein can be a potential target for drug development. Its involvement in different diseases and cellular processes makes it an attractive target for therapeutic intervention. However, further research is needed to better understand the precise mechanisms underlying ARAP1 function and to develop specific modulators of its activity.

Is the expression of the ARAP1 protein altered under specific physiological or pathological conditions? 03/02/2016

Yes, the expression of the ARAP1 protein can be altered under certain conditions. For instance, changes in ARAP1 expression have been observed during embryonic development, neuronal differentiation, and in various disease contexts, including cancer and cardiovascular diseases. Understanding these alterations in expression can help decipher its role in specific physiological or pathological processes.

Customer Reviews (8)

Write a review
Reviews
08/29/2021

    Whether I am studying protein interactions, cellular localization, or signaling pathways, the ARAP1 protein consistently delivers reliable and reproducible data, enabling significant scientific advancements.

    06/09/2021

      Its superior purity and stability ensure reliable and accurate results, instilling confidence in my research.

      06/22/2019

        the ARAP1 protein's compatibility with various experimental techniques further supports its usability.

        03/26/2019

          Their assistance has been invaluable in streamlining my experiments and overcoming obstacles effectively.

          03/07/2019

            Its versatility and reliability make it a great choice for researchers exploring protein dynamics, function, and interactions.

            05/08/2017

              ts reliability and high quality make it a valuable tool in various applications, ranging from enzymatic assays to studying protein-protein interactions.

              09/07/2016

                Its use in EM studies allows researchers to gain insights into the structural details of proteins and their complexes at high resolution.

                07/24/2016

                  the ARAP1 protein is highly regarded for its excellent performance in WB assays and its significant contribution to protein EM structure analysis.

                  Ask a Question for All ARAP1 Products

                  Required fields are marked with *

                  My Review for All ARAP1 Products

                  Required fields are marked with *

                  0

                  Inquiry Basket

                  cartIcon
                  logo

                  FOLLOW US

                  Terms and Conditions        Privacy Policy

                  Copyright © 2024 Creative BioMart. All Rights Reserved.

                  Contact Us

                  • /

                  Stay Updated on the Latest Bioscience Trends