Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IL13

Cat.No. : IL13-28497TH
Product Overview : Full length Human Recombinant IL13 is a single, non-glycosylated polypeptide chain containing 112 amino acids. M.Wt 12 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Source : E. coli
Form : Lyophilised:Reconstitutein sterile 18MOhm/cm water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS, pH 7.2
Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Sequence Similarities : Belongs to the IL-4/IL-13 family.
Gene Name : IL13 interleukin 13 [ Homo sapiens ]
Official Symbol : IL13
Synonyms : IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600;
Gene ID : 3596
mRNA Refseq : NM_002188
Protein Refseq : NP_002179
MIM : 147683
Uniprot ID : P35225
Chromosome Location : 5q31
Pathway : Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem;
Function : cytokine activity; interleukin-13 receptor binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends