Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IL4R, Fc-tagged

Cat.No. : IL4R-28641TH
Product Overview : Recombinant fragment, corresponding to the signal peptide and extracellular amino acids 1-232 of Human IL4R fused to the Fc region of human IgG1. The chimeric protein was expressed in modified human 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene.
Conjugation : Fc
Biological activity : The ED50 of IL4R - Fc Chimera is typically 45-60 ng/ml as measured by its ability to neutralize IL-4 mediated proliferation of the human growth factor dependent TF-1 cell line.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Theoretical Sequence:MKVLQEPTCVSDYMSISTCEWKMNGPTNC STELRLLYQLVFLLSEAHTCIPEN NGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPS EHVKPRAPGNL TVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDP ADFRIYNVTYLEP SLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWH NSYREPFEQHG SSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene Name : IL4R interleukin 4 receptor [ Homo sapiens ]
Official Symbol : IL4R
Synonyms : IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124;
Gene ID : 3566
mRNA Refseq : NM_000418
Protein Refseq : NP_000409
MIM : 147781
Uniprot ID : P24394
Chromosome Location : 16p12.1-p11.2
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; IL-4 signaling Pathway, organism-specific biosystem;
Function : insulin receptor substrate binding; interleukin-4 receptor activity; protein binding; receptor activity; receptor signaling protein activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
How about function of IL4R? 10/15/2022

IL4R is a synthetic protein that mimics the IL-4 signaling pathway in nature and binds to the IL-4 receptor in cells, which can be used to study the IL-4 signaling pathway and related diseases.

What is the production technology of IL4R? 02/23/2022

Common IL4R production technologies include prokaryotic expression systems and mammalian cell expression systems.

Which application of IL4R in tumor therapy? 01/26/2022

This protein is used in tumor immunotherapy, which can promote anti-tumor immune response and enhance the anti-tumor effect of cytotoxic T lymphocytes.

In what fields does IL4R have applications? 07/09/2021

It is mainly used in immunology, drug research and other fields. It is also widely used in vaccines, biotechnology, cancer treatment and so on.

Are there have application of IL4R in the treatment of asthma? 03/23/2021

IL4R is used to treat severe pheochromocytome-induced aerodoritis and was approved by the FDA as the first drug to treat this disease.

Can IL4R be administered orally? 05/08/2020

IL4R cannot generally be administered orally, and needs to be administered by injection or intravenous drip.

Customer Reviews (3)

Write a review
Reviews
06/30/2022

    Easy to attach to the surface of cells or materials.

    09/29/2021

      It has growth factor activity to promote cell growth and proliferation.

      02/27/2019

        In animals or humans caused by the prone production of antibodies.

        Ask a Question for All IL4R Products

        Required fields are marked with *

        My Review for All IL4R Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends