Recombinant Human PSAP, His-tagged
Cat.No. : | PSAP-30347TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 255-526 of Human PSAP with N terminal His tag; 272 amino acids, 32kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | MMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNV IPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLID NNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDP YQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS AHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHV WN |
Sequence Similarities : | Contains 2 saposin A-type domains.Contains 4 saposin B-type domains. |
Gene Name : | PSAP prosaposin [ Homo sapiens ] |
Official Symbol : | PSAP |
Synonyms : | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; |
Gene ID : | 5660 |
mRNA Refseq : | NM_001042465 |
Protein Refseq : | NP_001035930 |
MIM : | 176801 |
Uniprot ID : | P07602 |
Chromosome Location : | 10q21-q22 |
Pathway : | Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; |
Function : | enzyme activator activity; lipid binding; |
Products Types
◆ Recombinant Protein | ||
PSAP-01H | Recombinant Human PSAP Protein, His-tagged | +Inquiry |
PSAP-7197M | Recombinant Mouse PSAP Protein, His (Fc)-Avi-tagged | +Inquiry |
PSAP-4415R | Recombinant Rat PSAP Protein, His (Fc)-Avi-tagged | +Inquiry |
PSAP-5504H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
PSAP-3377H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
◆ Lysates | ||
PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket