"IL22" Related Products

GMP Recombinant Human IL22 protein

Cat.No.: IL22-4335HG
Product Overview: Recombinant Human IL22 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Description: IL-22 is belonging to IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes and dendritic cells, IL-10 contributes to the inflammatory response in vivo. IL-22 signals through CRF2-4 and IL-22. It along with IL-17 is rapidly produced by splenic LTi-like cells and can be also produced by Th17 cells and likely plays a role in the coordinated response of both adaptive and innate immune systems.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 5.0.
Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 × 10^6 IU/mg.
Molecular Mass: Approximately 33.6 kDa, non-disulfide-linked homodimeric protein containing of two 147 amino acid polypeptide chains.
AA Sequence: MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Endotoxin: Less than 1 EU/µg of rHuIL-22 as determined by LAL method.
Purity: > 97 % by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: IL22 interleukin 22 [ Homo sapiens ]
Official Symbol: IL22
Synonyms: IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23;
Gene ID: 50616
mRNA Refseq: NM_020525
Protein Refseq: NP_065386
MIM: 605330
UniProt ID: Q9GZX6

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.